| Thread Tools |
7th January 2003, 23:34 | #1 |
Posts: n/a
| funny console thingy? my f@h thingy is doin' some weird stuff lately : [January 7 21:48:04] Working on Unit 02 + Working ... [21:48:04] Genome@Home2 Core Version 2.02 (Sept 5, 2002) [21:48:04] [21:48:04] Proj: work/wudata_02 [21:48:04] Finding work files [21:48:04] sizeof(CORE_PACKET_HDR) = 512 [21:48:04] Checking frame files [21:48:04] - Couldn't open work/wudata_02.chk [21:48:04] Starting from initial work packet [21:48:04] [21:48:04] Updating shared core-client information [21:48:04] - Writing "work/wudata_02.key": (overwrite)successful. [21:48:04] Key file to update shared file: work/wudata_02.key [21:48:04] keyfile: 0 30 200 15 2 1 0 [21:48:04] Protein: 1tst/pdb1tst.xyz [21:48:04] - Frames Completed: 0, Remaining: 6000 [21:48:04] - Dynamic steps required: 1200000 [21:48:04] [21:48:05] Printed current.prm [21:48:05] Writing local files: [21:48:05] - Writing "work/wudata_02.key": (overwrite)successful. [21:48:05] - Writing "work/wudata_02.xyz": (overwrite)successful. [21:48:05] - Writing "work/wudata_02.prm": (overwrite)successful. [21:48:05] [SPA] project name: work/wudata_02. [21:48:05] [SPA] 1 0 [21:48:05] [SPA] Initializing protein design algorithm [21:48:05] [SPA] seed = 0 [21:48:05] [SPA] Initialization complete [21:48:05] [SPA] Writing current.pdb, chainlength = 30 [21:48:05] [SPA] Writing current.xyz [21:48:05] [SPA] Filtering . . . [21:48:05] [Filter] 30 positions to filter [21:48:05] [Filter] 30 positions to filter [21:48:05] [Filter] 1 filtered [21:48:05] [Filter] 2 filtered [21:48:06] [Filter] 3 filtered [21:48:06] [Filter] 4 filtered [21:48:11] [Filter] 5 filtered [21:48:11] [Filter] 6 filtered [21:48:11] [Filter] 7 filtered [21:48:11] [Filter] 8 filtered [21:48:12] [Filter] 9 filtered [21:48:12] [Filter] 10 filtered [21:48:12] [Filter] 11 filtered [21:48:12] [Filter] 12 filtered [21:48:12] [Filter] 13 filtered [21:48:13] [Filter] 14 filtered [21:48:13] [Filter] 15 filtered [21:48:13] [Filter] 16 filtered [21:48:13] [Filter] 17 filtered [21:48:13] [Filter] 18 filtered [21:48:15] [Filter] 19 filtered [21:48:15] [Filter] 20 filtered [21:48:16] [Filter] 21 filtered [21:48:16] [Filter] 22 filtered [21:48:18] [Filter] 23 filtered [21:48:18] [Filter] 24 filtered [21:48:18] [Filter] 25 filtered [21:48:18] [Filter] 26 filtered [21:48:18] [Filter] 27 filtered [21:48:19] [Filter] 28 filtered [21:48:19] [Filter] 29 filtered [21:48:19] [SPA] Filter complete [21:48:19] Iterations: 0 of 6000 [21:48:20] Finished [21:48:55] [SPA] Energy_Lookup [21:48:56] [SPA] rotamer wheel done [21:48:56] [SPA] seed: 14893390 [21:48:56] [SPA] Designing protein sequence 1 of 30 [21:49:41] [SPA] 10.0 % [21:50:18] [SPA] 20.0 % [21:50:50] [SPA] 30.0 % [21:51:22] [SPA] 40.0 % [21:51:53] [SPA] 50.0 % [21:52:24] [SPA] 60.0 % [21:52:55] [SPA] 70.0 % [21:53:27] [SPA] 80.0 % [21:54:00] [SPA] 90.0 % [21:54:32] [SPA] 100.0 % [21:54:32] [SPA] Sequence 1 completed: [21:54:32] TYTRMNSYRREAGSGTPTFTPGEPHKVSGS [21:54:32] Iterations: 200 of 6000 [21:54:33] Finished [21:54:33] [SPA] seed: 29786780 and so on... wtf? never seen that stuff before, on none of my folding stations... |
7th January 2003, 23:37 | #2 |
Madshrimp Join Date: May 2002 Location: 7090/Belgium
Posts: 79,022
| Genome@Home2 Core Version 2.02 (Sept 5, 2002) GNOME Work Unit worth... 0.78 points set advanced options in the console, chose FAH
__________________ |
7th January 2003, 23:38 | #3 |
Posts: n/a
| same here |
7th January 2003, 23:39 | #4 |
Posts: n/a
| ah, tnx for the info [size=0.1]tnx for editing, was wasting valuable database space [/size] |
7th January 2003, 23:48 | #5 | |
Madshrimp Join Date: May 2002 Location: 7090/Belgium
Posts: 79,022
| Quote:
__________________ | |
Similar Threads | ||||
Thread | Thread Starter | Forum | Replies | Last Post |
Console Gamers Get Killed against PC Gamers | jmke | WebNews | 1 | 24th July 2010 20:07 |
DUH! News of the Day: Wii is the Most Popular Game Console Among Women | jmke | WebNews | 1 | 27th November 2009 10:56 |
PCs Played More Than Any Console! | jmke | WebNews | 0 | 12th August 2008 16:13 |
IBM Adds Videogame Console Chips to Mainframes | jmke | WebNews | 0 | 26th April 2007 21:22 |
On the eve of next-gen console mania, the old and jaggy PS2 rules the roost | jmke | WebNews | 0 | 13th November 2006 08:40 |
SNES- As Good As Console Gaming Is Going to Get" | Sidney | WebNews | 0 | 3rd September 2005 18:29 |
Xbox 2: first of next-generation console to be released | jmke | WebNews | 0 | 19th June 2004 01:04 |
Thread Tools | |
| |