It appears you have not yet registered with our community. To register please click here...

 
Go Back [M] > Madshrimps > Site & Forum Feedback - Folding@Home
funny console thingy? funny console thingy?
FAQ Members List Calendar Search Today's Posts Mark Forums Read


funny console thingy?
Closed Thread
 
Thread Tools
Old 7th January 2003, 23:34   #1
Magnum_
 
Posts: n/a
Default funny console thingy?

my f@h thingy is doin' some weird stuff lately :


[January 7 21:48:04] Working on Unit 02
+ Working ...
[21:48:04] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[21:48:04]
[21:48:04] Proj: work/wudata_02
[21:48:04] Finding work files
[21:48:04] sizeof(CORE_PACKET_HDR) = 512
[21:48:04] Checking frame files
[21:48:04] - Couldn't open work/wudata_02.chk
[21:48:04] Starting from initial work packet
[21:48:04]
[21:48:04] Updating shared core-client information
[21:48:04] - Writing "work/wudata_02.key": (overwrite)successful.
[21:48:04] Key file to update shared file: work/wudata_02.key
[21:48:04] keyfile: 0 30 200 15 2 1 0
[21:48:04] Protein: 1tst/pdb1tst.xyz
[21:48:04] - Frames Completed: 0, Remaining: 6000
[21:48:04] - Dynamic steps required: 1200000
[21:48:04]
[21:48:05] Printed current.prm
[21:48:05] Writing local files:
[21:48:05] - Writing "work/wudata_02.key": (overwrite)successful.
[21:48:05] - Writing "work/wudata_02.xyz": (overwrite)successful.
[21:48:05] - Writing "work/wudata_02.prm": (overwrite)successful.
[21:48:05] [SPA] project name: work/wudata_02.
[21:48:05] [SPA] 1 0
[21:48:05] [SPA] Initializing protein design algorithm
[21:48:05] [SPA] seed = 0
[21:48:05] [SPA] Initialization complete
[21:48:05] [SPA] Writing current.pdb, chainlength = 30
[21:48:05] [SPA] Writing current.xyz
[21:48:05] [SPA] Filtering . . .
[21:48:05] [Filter] 30 positions to filter
[21:48:05] [Filter] 30 positions to filter
[21:48:05] [Filter] 1 filtered
[21:48:05] [Filter] 2 filtered
[21:48:06] [Filter] 3 filtered
[21:48:06] [Filter] 4 filtered
[21:48:11] [Filter] 5 filtered
[21:48:11] [Filter] 6 filtered
[21:48:11] [Filter] 7 filtered
[21:48:11] [Filter] 8 filtered
[21:48:12] [Filter] 9 filtered
[21:48:12] [Filter] 10 filtered
[21:48:12] [Filter] 11 filtered
[21:48:12] [Filter] 12 filtered
[21:48:12] [Filter] 13 filtered
[21:48:13] [Filter] 14 filtered
[21:48:13] [Filter] 15 filtered
[21:48:13] [Filter] 16 filtered
[21:48:13] [Filter] 17 filtered
[21:48:13] [Filter] 18 filtered
[21:48:15] [Filter] 19 filtered
[21:48:15] [Filter] 20 filtered
[21:48:16] [Filter] 21 filtered
[21:48:16] [Filter] 22 filtered
[21:48:18] [Filter] 23 filtered
[21:48:18] [Filter] 24 filtered
[21:48:18] [Filter] 25 filtered
[21:48:18] [Filter] 26 filtered
[21:48:18] [Filter] 27 filtered
[21:48:19] [Filter] 28 filtered
[21:48:19] [Filter] 29 filtered
[21:48:19] [SPA] Filter complete
[21:48:19] Iterations: 0 of 6000
[21:48:20] Finished
[21:48:55] [SPA] Energy_Lookup
[21:48:56] [SPA] rotamer wheel done
[21:48:56] [SPA] seed: 14893390
[21:48:56] [SPA] Designing protein sequence 1 of 30
[21:49:41] [SPA] 10.0 %
[21:50:18] [SPA] 20.0 %
[21:50:50] [SPA] 30.0 %
[21:51:22] [SPA] 40.0 %
[21:51:53] [SPA] 50.0 %
[21:52:24] [SPA] 60.0 %
[21:52:55] [SPA] 70.0 %
[21:53:27] [SPA] 80.0 %
[21:54:00] [SPA] 90.0 %
[21:54:32] [SPA] 100.0 %
[21:54:32] [SPA] Sequence 1 completed:
[21:54:32] TYTRMNSYRREAGSGTPTFTPGEPHKVSGS
[21:54:32] Iterations: 200 of 6000
[21:54:33] Finished
[21:54:33] [SPA] seed: 29786780



and so on...

wtf? never seen that stuff before, on none of my folding stations...
 
Old 7th January 2003, 23:37   #2
Madshrimp
 
jmke's Avatar
 
Join Date: May 2002
Location: 7090/Belgium
Posts: 79,022
jmke has disabled reputation
Default

Genome@Home2 Core Version 2.02 (Sept 5, 2002)


GNOME Work Unit

worth... 0.78 points

set advanced options in the console, chose FAH
__________________
jmke is offline  
Old 7th January 2003, 23:38   #3
stronken
 
Posts: n/a
Default

same here
 
Old 7th January 2003, 23:39   #4
Magnum_
 
Posts: n/a
Default

ah, tnx for the info

[size=0.1]tnx for editing, was wasting valuable database space [/size]
 
Old 7th January 2003, 23:48   #5
Madshrimp
 
jmke's Avatar
 
Join Date: May 2002
Location: 7090/Belgium
Posts: 79,022
jmke has disabled reputation
Default

Quote:
Originally posted by Magnum_
[size=0.1]tnx for editing, was wasting valuable database space [/size]
saving my scrollwheel actually
__________________
jmke is offline  
Closed Thread


Similar Threads
Thread Thread Starter Forum Replies Last Post
Console Gamers Get Killed against PC Gamers jmke WebNews 1 24th July 2010 20:07
DUH! News of the Day: Wii is the Most Popular Game Console Among Women jmke WebNews 1 27th November 2009 10:56
PCs Played More Than Any Console! jmke WebNews 0 12th August 2008 16:13
IBM Adds Videogame Console Chips to Mainframes jmke WebNews 0 26th April 2007 21:22
On the eve of next-gen console mania, the old and jaggy PS2 rules the roost jmke WebNews 0 13th November 2006 08:40
SNES- As Good As Console Gaming Is Going to Get" Sidney WebNews 0 3rd September 2005 18:29
Xbox 2: first of next-generation console to be released jmke WebNews 0 19th June 2004 01:04

Thread Tools

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

vB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are Off
Pingbacks are Off
Refbacks are Off


All times are GMT +1. The time now is 06:27.


Powered by vBulletin® - Copyright ©2000 - 2024, Jelsoft Enterprises Ltd.
SEO by vBSEO